PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv6_144930_oqgf.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family HD-ZIP
Protein Properties Length: 299aa    MW: 33400.3 Da    PI: 6.3149
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv6_144930_oqgf.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.74.1e-1887140356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k+++++ eq+++Le+ Fe  +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  Bv6_144930_oqgf.t1  87 KKRRLNMEQVKTLEKNFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWK 140
                         456899***********************************************9 PP

2HD-ZIP_I/II131.43.4e-4286178193
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrl+ eqvk+LE++Fe  +kLeperK++la++Lglqprq+a+WFqnrRAR+ktkqlEkdy+ Lkr++dalk++n++L++++++L++e+
  Bv6_144930_oqgf.t1  86 EKKRRLNMEQVKTLEKNFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLEKDYDILKRQFDALKADNDTLQAQNHKLQAEI 176
                         69**************************************************************************************999 PP

         HD-ZIP_I/II  92 ke 93 
                         ++
  Bv6_144930_oqgf.t1 177 MA 178
                         75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.24E-1973144IPR009057Homeodomain-like
PROSITE profilePS5007116.94182142IPR001356Homeobox domain
SMARTSM003891.0E-1785146IPR001356Homeobox domain
CDDcd000866.68E-1787143No hitNo description
PfamPF000462.0E-1587140IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.7E-1989149IPR009057Homeodomain-like
PRINTSPR000311.1E-5113122IPR000047Helix-turn-helix motif
PROSITE patternPS000270117140IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5122138IPR000047Helix-turn-helix motif
PfamPF021831.2E-17142182IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0048826Biological Processcotyledon morphogenesis
GO:0080022Biological Processprimary root development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MLQTPTDNDN HPPPSLSSIL PSCTTQDFHV GTGGMAPMLG KRSMSFSGID MCEELNKNHH  60
NNHNNNNNGG DEDLSDDGSQ LGGGGEKKRR LNMEQVKTLE KNFELGNKLE PERKMQLAKA  120
LGLQPRQIAI WFQNRRARWK TKQLEKDYDI LKRQFDALKA DNDTLQAQNH KLQAEIMALK  180
NREPTESINL NKETEGSCSN RSENSSDIKL DISRTPTITE SPLLDLSAHP TTTASAATTV  240
TGKTLFPPSS MRPNGPPVAQ LLFQSPQPPS VKEETFTSMF CGIDDQTGFW PWLEQHNFN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134142RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00225DAPTransfer from AT1G69780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010681985.10.0PREDICTED: homeobox-leucine zipper protein ATHB-13-like
RefseqXP_010681986.10.0PREDICTED: homeobox-leucine zipper protein ATHB-13-like
RefseqXP_010683229.10.0PREDICTED: homeobox-leucine zipper protein ATHB-13
RefseqXP_010683230.10.0PREDICTED: homeobox-leucine zipper protein ATHB-13
SwissprotQ8LC031e-107ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A0J8C6V70.0A0A0J8C6V7_BETVU; Uncharacterized protein
STRINGVIT_01s0026g01950.t011e-132(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.16e-86HD-ZIP family protein